PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00131.1_g00011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 314aa    MW: 35407.2 Da    PI: 7.2226
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00131.1_g00011.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.25.2e-153380148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g W+++Ede+l+ +    G g+W+ Iar  g+ R++k+c++rw +yl
  Rsa1.0_00131.1_g00011.1 33 KGLWSPDEDEKLISYMLTNGQGCWNVIARNAGLLRCGKSCRLRWINYL 80
                             678*****************************99************97 PP

2Myb_DNA-binding49.59.6e-1686130147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg++++eE+ l+v+++ + G++ W+ Ia  ++ gRt++++k++w++ 
  Rsa1.0_00131.1_g00011.1  86 RGPFSPEEEYLIVHLHSMIGNR-WSQIATQLP-GRTDNEIKNFWNTT 130
                              89********************.*********.************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.1982880IPR017930Myb domain
SuperFamilySSF466897.19E-2831127IPR009057Homeodomain-like
SMARTSM007175.3E-123282IPR001005SANT/Myb domain
PfamPF002491.0E-133380IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.0E-223487IPR009057Homeodomain-like
CDDcd001673.39E-103680No hitNo description
PROSITE profilePS5129424.99781135IPR017930Myb domain
SMARTSM007175.5E-1585133IPR001005SANT/Myb domain
PfamPF002492.1E-1486130IPR001005SANT/Myb domain
CDDcd001678.82E-1188131No hitNo description
Gene3DG3DSA:1.10.10.604.8E-2688135IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MMRNSAITKI IDKNKLKHAC GGTGNNNKRK LRKGLWSPDE DEKLISYMLT NGQGCWNVIA  60
RNAGLLRCGK SCRLRWINYL RPDLKRGPFS PEEEYLIVHL HSMIGNRWSQ IATQLPGRTD  120
NEIKNFWNTT LKKRLENNIN NTSSGSLPTN IICNFLDPKD QHVNMEGKSN PMMDSNHHHD  180
DMMVVGNTMR IGCSSFSFAP VVSGVDLNQL DQLISVPDHN SYQQMGNMGN LFNVNGLRYC  240
GNAILDPTSK RTSIQSEWFL PPSEDTNVIP CTTNNNLNML GVENGSLEIE HPKIGDLDLD  300
GLIDNNPLFT FLDF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26311365109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013740976.11e-154PREDICTED: transcription factor TT2-like
TrEMBLA0A078CGD01e-154A0A078CGD0_BRANA; BnaA03g30340D protein
TrEMBLA0A0D3BAA01e-154A0A0D3BAA0_BRAOL; Uncharacterized protein
TrEMBLM4CAQ51e-154M4CAQ5_BRARP; Uncharacterized protein
STRINGBra001284.1-P1e-153(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70772642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.11e-124myb domain protein 83